CacheBy
Atlas Antibodies Anti-BRPF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRPF1 Antibody

상품 한눈에 보기

인간 BRPF1 단백질을 인식하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합. Rabbit에서 생성된 IgG 항체이며, 고순도 Affinity 정제 방식 적용. RNA-seq 데이터와 비교하여 단백질 발현 검증 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA003359-100 Anti-BRPF1 Antibody, bromodomain and PHD finger containing, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003359-25 Anti-BRPF1 Antibody, bromodomain and PHD finger containing, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRPF1 Antibody

Anti-BRPF1 Antibody

Target: bromodomain and PHD finger containing, 1 (BRPF1)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human BRPF1


Alternative Gene Names

  • BR140

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein bromodomain and PHD finger containing, 1
Target Gene BRPF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTD
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008142 (94%), Mouse ENSMUSG00000001632 (94%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.