CacheBy
Atlas Antibodies Anti-BRPF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRPF1 Antibody

상품 한눈에 보기

인간 BRPF1 단백질을 인식하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합. Rabbit에서 생성된 IgG 항체이며, 고순도 Affinity 정제 방식 적용. RNA-seq 데이터와 비교하여 단백질 발현 검증 가능.

카탈로그번호
HPA003359-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003359-100 Anti-BRPF1 Antibody, bromodomain and PHD finger containing, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003359-25 Anti-BRPF1 Antibody, bromodomain and PHD finger containing, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRPF1 Antibody

Anti-BRPF1 Antibody

Target: bromodomain and PHD finger containing, 1 (BRPF1)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human BRPF1


Alternative Gene Names

  • BR140

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein bromodomain and PHD finger containing, 1
Target Gene BRPF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTD
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008142 (94%), Mouse ENSMUSG00000001632 (94%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.