CacheBy
Atlas Antibodies Anti-BRPF3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRPF3 Antibody

상품 한눈에 보기

인간 BRPF3 단백질을 타겟으로 하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. 토끼 유래 IgG 항체로 PrEST 항원 기반 친화 정제. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA022787-100 Anti-BRPF3 Antibody, bromodomain and PHD finger containing, 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022787-25 Anti-BRPF3 Antibody, bromodomain and PHD finger containing, 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRPF3 Antibody

Anti-BRPF3 Antibody

Target: bromodomain and PHD finger containing, 3
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human BRPF3.

Alternative Gene Names

  • KIAA1286

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein bromodomain and PHD finger containing, 3
Target Gene BRPF3
Verified Species Reactivity Human
Interspecies Identity Mouse (83%), Rat (82%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SDNGINRLSLMAPDTPAGTPLSGVGRRTSVLFKKAKNGVKLQRSPDRVLENGEDHGVAGSPASPASIEEERHSRKRPRSRSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSGGLAFEACSGLTPPKRSRG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.