
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BMPR2 Antibody
상품 한눈에 보기
Human BMPR2 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 연구 응용에 적합하며, 높은 종간 반응성(인간, 마우스, 랫트)을 보임. 안정적 PBS/glycerol buffer로 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA049014-100 Anti-BMPR2 Antibody, bone morphogenetic protein receptor, type II (serine/threonine kinase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049014-25 Anti-BMPR2 Antibody, bone morphogenetic protein receptor, type II (serine/threonine kinase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BMPR2 Antibody
Anti-BMPR2 Antibody
Target: Bone morphogenetic protein receptor, type II (serine/threonine kinase)
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against Human BMPR2.
Alternative Gene Names
BMPR-II, BMPR3, BRK-3, PPH1, T-ALK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Bone morphogenetic protein receptor, type II (serine/threonine kinase) |
| Target Gene | BMPR2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (100%), Rat (99%) |
Antigen Sequence:
PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSF
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



