CacheBy
Atlas Antibodies Anti-BMPR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BMPR2 Antibody

상품 한눈에 보기

인체 BMPR2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA017385-100 Anti-BMPR2 Antibody, bone morphogenetic protein receptor, type II (serine/threonine kinase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017385-25 Anti-BMPR2 Antibody, bone morphogenetic protein receptor, type II (serine/threonine kinase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BMPR2 Antibody

Anti-BMPR2 Antibody

Target: bone morphogenetic protein receptor, type II (serine/threonine kinase)
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합


Product Description

Polyclonal antibody against human BMPR2.


Alternative Gene Names

BMPR-II, BMPR3, BRK-3, PPH1, T-ALK

Open Datasheet


Target Information

항목 내용
Target Protein bone morphogenetic protein receptor, type II (serine/threonine kinase)
Target Gene BMPR2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000067336 (100%), Rat ENSRNOG00000022196 (99%)

Antigen Sequence:
PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSF


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.