CacheBy
Atlas Antibodies Anti-BMP7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BMP7 Antibody

상품 한눈에 보기

인간 BMP7 단백질에 특이적인 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에서 검증되었으며, Mouse 및 Rat에서도 높은 서열 동일성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057757-100 Anti-BMP7 Antibody, bone morphogenetic protein 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057757-25 Anti-BMP7 Antibody, bone morphogenetic protein 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BMP7 Antibody

Anti-BMP7 Antibody

Target Information

  • Target Protein: Bone morphogenetic protein 7
  • Target Gene: BMP7
  • Alternative Gene Names: OP-1

Product Description

Polyclonal antibody against human BMP7.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    AFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000053384): 95%
  • Mouse (ENSMUSG00000008999): 95%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

ICC (Immunocytochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

References

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.