Atlas Antibodies Anti-BMP6 Antibody

상품 한눈에 보기

인체 BMP6 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 순도 확보. ICC 등 다양한 응용 가능하며 Human에 검증된 반응성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062683-100 Anti-BMP6 Antibody, bone morphogenetic protein 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062683-25 Anti-BMP6 Antibody, bone morphogenetic protein 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Bone morphogenetic protein 6 (BMP6)
Supplier: Atlas Antibodies

Polyclonal antibody against human BMP6.

항목	내용
Target Protein	Bone morphogenetic protein 6
Target Gene	BMP6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat (95%), Mouse (89%)

Antigen Sequence:
FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data	Material Safety Data Sheet