원본

Atlas Antibodies Anti-BLVRA Antibody

상품 한눈에 보기

Human BLVRA 단백질을 인식하는 토끼 폴리클로날 항체로, Western Blot과 Immunocytochemistry에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대한 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042865-100 Anti-BLVRA Antibody, biliverdin reductase A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042865-25 Anti-BLVRA Antibody, biliverdin reductase A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human biliverdin reductase A (BLVRA).

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL

Verified Species Reactivity: Human
Interspecies Identity:
- Mouse (ENSMUSG00000001999): 86%
- Rat (ENSRNOG00000011778): 85%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Storage & Handling	Gently mix before use. Optimal concentrations and conditions should be determined by the user.