
원본
Atlas Antibodies Anti-BLVRA Antibody
상품 한눈에 보기
Human BLVRA 단백질을 인식하는 토끼 폴리클로날 항체로, Western Blot과 Immunocytochemistry에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대한 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA042865-100 Anti-BLVRA Antibody, biliverdin reductase A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042865-25 Anti-BLVRA Antibody, biliverdin reductase A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BLVRA Antibody
Anti-BLVRA Antibody
Target Information
- Target Protein: biliverdin reductase A
- Target Gene: BLVRA
- Alternative Gene Names: BLVR
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human biliverdin reductase A (BLVRA).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL
Species Reactivity
- Verified Species Reactivity: Human
- Interspecies Identity:
- Mouse (ENSMUSG00000001999): 86%
- Rat (ENSRNOG00000011778): 85%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Storage & Handling | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



