CacheBy
Atlas Antibodies Anti-BIRC6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BIRC6 Antibody

상품 한눈에 보기

인간 BIRC6 단백질을 인식하는 토끼 폴리클로날 항체. 면역세포염색(ICC) 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA074738-100 Anti-BIRC6 Antibody, baculoviral IAP repeat containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074738-25 Anti-BIRC6 Antibody, baculoviral IAP repeat containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BIRC6 Antibody

Anti-BIRC6 Antibody

Target Protein: baculoviral IAP repeat containing 6 (BIRC6)
Alternative Gene Name: BRUCE

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human BIRC6.

Target Information

항목 내용
Target Protein baculoviral IAP repeat containing 6
Target Gene BIRC6
Alternative Gene Name BRUCE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000027191 (99%), Mouse ENSMUSG00000024073 (99%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.