
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BIRC6 Antibody
상품 한눈에 보기
인간 BIRC6 단백질을 인식하는 토끼 폴리클로날 항체. 면역세포염색(ICC) 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 글리세롤 및 PBS 완충액에 보존.
- 카탈로그번호
- HPA074738-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA074738-100 Anti-BIRC6 Antibody, baculoviral IAP repeat containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074738-25 Anti-BIRC6 Antibody, baculoviral IAP repeat containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BIRC6 Antibody
Anti-BIRC6 Antibody
Target Protein: baculoviral IAP repeat containing 6 (BIRC6)
Alternative Gene Name: BRUCE
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human BIRC6.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | baculoviral IAP repeat containing 6 |
| Target Gene | BIRC6 |
| Alternative Gene Name | BRUCE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000027191 (99%), Mouse ENSMUSG00000024073 (99%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



