Thermo Fisher Scientific Beclin 1 Recombinant Rabbit Monoclonal Antibody (9D8K9)
Beclin 1 단백질을 표적으로 하는 Thermo Fisher Scientific의 재조합 토끼 단클론 항체(9D8K9). Western blot, ICC/IF, ELISA 등에 적합하며 인간, 마우스, 랫트 반응성. HEK293 세포 발현, 고순도 친화 크로마토그래피 정제, 액상 형태로 -20°C 보관.
- 카탈로그번호
- MA551201
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Beclin 1 Recombinant Rabbit Monoclonal Antibody (9D8K9)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:2,000–1:10,000 |
| Immunocytochemistry (ICC/IF) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Expression System | HEK293 cells |
| Class | Recombinant Monoclonal |
| Type | Antibody |
| Clone | 9D8K9 |
| Immunogen | Recombinant fusion protein containing amino acids 1–280 of human Beclin 1 (NP_003757.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.2 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.3, with 0.05% BSA, 50% glycerol |
| Contains | 0.05% ProClin 300 |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_3094195 |
Product Specific Information
Immunogen sequence:
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAEENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG
Target Information
Beclin 1은 자가포식(autophagy)에 중심적인 역할을 하는 단백질로, phosphatidylinositol 3-phosphate 형성을 매개하는 PI3K 복합체의 핵심 하위 단위로 작용합니다.
PI3KC3-C1 복합체는 자가포식소체의 시작에, PI3KC3-C2 복합체는 자가포식소체의 성숙 및 엔도시토시스 과정에 관여합니다. 또한 Beclin 1은 항바이러스 숙주 방어에도 중요한 역할을 합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.