CacheBy
Atlas Antibodies Anti-PCDHB4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCDHB4 Antibody

상품 한눈에 보기

인간 PCDHB4 단백질을 표적으로 하는 폴리클로날 항체입니다. 토끼에서 생산된 IgG 형식으로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, 높은 종간 반응성(인간, 마우스, 랫트)을 보입니다.

카탈로그번호
HPA014466-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014466-100 Anti-PCDHB4 Antibody, protocadherin beta 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014466-25 Anti-PCDHB4 Antibody, protocadherin beta 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCDHB4 Antibody

Anti-PCDHB4 Antibody

Target Information

  • Target Protein: protocadherin beta 4
  • Target Gene: PCDHB4
  • Alternative Gene Names: PCDH-BETA4

Product Description

Polyclonal antibody against human PCDHB4.
Recommended for applications such as immunohistochemistry (IHC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LCGPIEPCVLHFQVFLEMPVQFFQGELLIQDINDHSPIFPEREVLLKILENSQPGTLFPLLIAEDLDVGSNGLQKYTISPNSHFHILTRNHSEGKKYPDLV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000063687): 80%
  • Rat (ENSRNOG00000020084): 77%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.