CacheBy
Atlas Antibodies Anti-PATJ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PATJ Antibody

상품 한눈에 보기

Human PATJ 단백질을 인식하는 토끼 폴리클로날 항체로, 세포 극성 복합체 연구에 적합합니다. Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 추천됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA066960-100 Anti-PATJ Antibody, PATJ, crumbs cell polarity complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066960-25 Anti-PATJ Antibody, PATJ, crumbs cell polarity complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PATJ Antibody

Anti-PATJ Antibody

Target: PATJ, crumbs cell polarity complex component
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human PATJ protein.


Alternative Gene Names

  • Cipp
  • INADL

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein PATJ, crumbs cell polarity complex component
Target Gene PATJ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEI
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007551 (82%), Mouse ENSMUSG00000061859 (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.