
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PATE1 Antibody
상품 한눈에 보기
Human PATE1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합합니다. PATE1은 전립선 및 고환에서 발현되며, 높은 특이성과 정제된 품질을 제공합니다. PBS/glycerol 기반 안정화 버퍼 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA076587-100 Anti-PATE1 Antibody, prostate and testis expressed 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076587-25 Anti-PATE1 Antibody, prostate and testis expressed 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PATE1 Antibody
Anti-PATE1 Antibody
Target: Prostate and Testis Expressed 1 (PATE1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
OCR 텍스트: IHC (Immunohistochemistry) recommended application
Product Description
Polyclonal antibody against Human PATE1.
Alternative Gene Names
- PATE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Prostate and testis expressed 1 |
| Target Gene | PATE1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse 58%, Rat 56% |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LSGSLSMRNDAVNEIVAVKNNFPVIEIVRCRMCHLQFPGEKCSRGRGICTATTEE |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



