Atlas Antibodies Anti-PATJ Antibody

상품 한눈에 보기

Human PATJ 단백질을 인식하는 rabbit polyclonal 항체로, crumbs 세포 극성 복합체 연구에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, IHC 등 다양한 응용에 사용 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA066352-100 Anti-PATJ Antibody, PATJ, crumbs cell polarity complex component 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA066352-25 Anti-PATJ Antibody, PATJ, crumbs cell polarity complex component 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: PATJ, crumbs cell polarity complex component
Supplier: Atlas Antibodies

Polyclonal antibody against human PATJ protein, a component of the crumbs cell polarity complex.

항목	내용
Target Protein	PATJ, crumbs cell polarity complex component
Target Gene	PATJ
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	ATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEI

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand