Atlas Antibodies Anti-P3H3 Antibody

상품 한눈에 보기

Human P3H3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit host, IgG isotype이며, 프레스티 항원 기반으로 친화 정제되었습니다. Human, Mouse, Rat 종에 반응합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043695-100 Anti-P3H3 Antibody, prolyl 3-hydroxylase 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043695-25 Anti-P3H3 Antibody, prolyl 3-hydroxylase 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-P3H3 Antibody

Anti-P3H3 Antibody

Target Information

Target Protein: prolyl 3-hydroxylase 3
Target Gene: P3H3
Alternative Gene Names: GRCB, HSU47926, LEPREL2

Product Description

Polyclonal antibody against human P3H3.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PMHLQMREDMAKYRRMSGVRPQSFRDLETPPHWAAYDTGLELLGRQEAGLALPRLEEALQGSLAQMESCRADCEGPEEQQGAEEEEDGAASQGGLYEAIAGH

Verified Species Reactivity

Human
Mouse
Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000023191 (82%)
Rat ENSRNOG00000016071 (78%)

Technical Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use. Optimal conditions should be determined by the user.