CacheBy
Atlas Antibodies Anti-P2RX5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-P2RX5 Antibody

상품 한눈에 보기

Human P2RX5 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067827-100 Anti-P2RX5 Antibody, purinergic receptor P2X, ligand gated ion channel, 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067827-25 Anti-P2RX5 Antibody, purinergic receptor P2X, ligand gated ion channel, 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-P2RX5 Antibody

Anti-P2RX5 Antibody

Target: purinergic receptor P2X, ligand gated ion channel, 5
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human P2RX5.

Alternative Gene Names

  • LRH-1
  • P2X5

Open Datasheet

Target Information

  • Target Protein: purinergic receptor P2X, ligand gated ion channel, 5
  • Target Gene: P2RX5

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000019208 74%
Mouse ENSMUSG00000005950 74%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.