CacheBy
Atlas Antibodies Anti-P2RX4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-P2RX4 Antibody

상품 한눈에 보기

Human P2RX4 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체입니다. Rabbit host 기반 IgG 형식이며, Affinity purification으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039494-100 Anti-P2RX4 Antibody, purinergic receptor P2X, ligand-gated ion channel, 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039494-25 Anti-P2RX4 Antibody, purinergic receptor P2X, ligand-gated ion channel, 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-P2RX4 Antibody

Anti-P2RX4 Antibody

Target: purinergic receptor P2X, ligand-gated ion channel, 4
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human P2RX4.


Alternative Gene Names

  • P2X4

Target Information

항목 내용
Target Protein purinergic receptor P2X, ligand-gated ion channel, 4
Target Gene P2RX4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YCMKKRLYYREKKYKYVEDYEQGLASELDQ
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000029470 (83%), Rat ENSRNOG00000001300 (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.