CacheBy
Atlas Antibodies Anti-P2RX6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-P2RX6 Antibody

상품 한눈에 보기

Human P2RX6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤과 PBS 완충액에 보존되어 있습니다. 인간에서 검증되었으며, P2X6 수용체 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028777-100 Anti-P2RX6 Antibody, purinergic receptor P2X, ligand-gated ion channel, 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028777-25 Anti-P2RX6 Antibody, purinergic receptor P2X, ligand-gated ion channel, 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-P2RX6 Antibody

Anti-P2RX6 Antibody

Target: purinergic receptor P2X, ligand-gated ion channel, 6
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human P2RX6.


Alternative Gene Names

MGC129625, P2RXL1, P2X6, P2XM

Open Datasheet


Target Information

항목 내용
Target Protein purinergic receptor P2X, ligand-gated ion channel, 6
Target Gene P2RX6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQTQTPGWPCPSSDTHLPTHS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028977 (34%), Rat ENSRNOG00000013474 (32%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.