Atlas Antibodies Anti-OSGEPL1 Antibody

상품 한눈에 보기

인간 OSGEPL1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB(orthogonal), ICC 등 다양한 응용에 적합합니다. Rabbit에서 생성된 IgG 항체이며, PrEST 항원으로 정제되었습니다. 인간에 대해 검증된 반응성을 갖습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030693-100 Anti-OSGEPL1 Antibody, O-sialoglycoprotein endopeptidase-like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030693-25 Anti-OSGEPL1 Antibody, O-sialoglycoprotein endopeptidase-like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-OSGEPL1 Antibody

Anti-OSGEPL1 Antibody

Target: O-sialoglycoprotein endopeptidase-like 1
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, Orthogonal validation)
Immunocytochemistry (ICC)

Orthogonal validation:
Protein expression verified using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human OSGEPL1

Alternative Gene Names

Qri7

Open Datasheet

Target Information

항목	내용
Target Protein	O-sialoglycoprotein endopeptidase-like 1
Target Gene	OSGEPL1
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Verified Species Reactivity	Human
Highest Sequence Identity (Orthologs)	Rat: 93% (ENSRNOG00000004001), Mouse: 92% (ENSMUSG00000026096)

Antigen Sequence:

DETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSD

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet