CacheBy
Atlas Antibodies Anti-OSCAR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OSCAR Antibody

상품 한눈에 보기

Human OSCAR 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. 면역형광(ICC) 등 다양한 응용에 적합하며, 높은 특이성과 재현성을 제공. 40% glycerol 기반 buffer로 안정하게 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073996-100 Anti-OSCAR Antibody, osteoclast associated, immunoglobulin-like receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073996-25 Anti-OSCAR Antibody, osteoclast associated, immunoglobulin-like receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OSCAR Antibody

Anti-OSCAR Antibody

Target: Osteoclast Associated, Immunoglobulin-like Receptor (OSCAR)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human OSCAR protein.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Osteoclast associated, immunoglobulin-like receptor
Target Gene OSCAR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000054594 (73%), Rat ENSRNOG00000055716 (68%)

Antigen Sequence:

VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.