CacheBy
Atlas Antibodies Anti-OSGIN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OSGIN2 Antibody

상품 한눈에 보기

Human OSGIN2 단백질을 인식하는 토끼 폴리클로날 항체로, 산화 스트레스 유도 성장 억제 단백질 연구에 적합. IHC 등 다양한 응용 가능. PrEST 항원으로 친화 정제됨. 인간에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050595-100 Anti-OSGIN2 Antibody, oxidative stress induced growth inhibitor family member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050595-25 Anti-OSGIN2 Antibody, oxidative stress induced growth inhibitor family member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OSGIN2 Antibody

Anti-OSGIN2 Antibody

Target: Oxidative stress induced growth inhibitor family member 2 (OSGIN2)
Type: Polyclonal Antibody against Human OSGIN2

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human OSGIN2 protein.

Alternative Gene Names

  • C8orf1
  • hT41

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Oxidative stress induced growth inhibitor family member 2
Target Gene OSGIN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
SNFIKRNWEIRGYQRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSG

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000041153 93%
Rat ENSRNOG00000009358 90%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.