
원본
Thermo Fisher Scientific Cyclin T1 Polyclonal Antibody
상품 한눈에 보기
Cyclin T1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됨. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 31. 오전 01:56
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578944 Cyclin T1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific Cyclin T1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg / 1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human Cyclin T1 (375–410 aa): QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746060 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cyclin T1은 cyclin C 하위 패밀리에 속하는 단백질로, cyclin-dependent kinase 9(CDK9)와 결합하여 positive transcription elongation factor b (p-TEFb)의 주요 구성 요소로 작용합니다. 이 복합체는 HIV-1 Tat 단백질의 보조인자로서 바이러스 전사의 완전한 활성화를 위해 필요하며, RNA polymerase II의 carboxy-terminal domain을 인산화하여 전사 연장을 유도합니다. Cyclin T1의 과발현은 종양 성장과 관련이 있으며, 대체 스플라이싱을 통해 여러 전사 변이체가 생성됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
