
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-OPLAH Antibody
상품 한눈에 보기
인간 OPLAH 단백질을 인식하는 토끼 폴리클로날 항체. 5-oxoprolinase(ATP-hydrolysing) 검출에 적합. PrEST 항원으로 친화 정제됨. IHC 등 다양한 응용에 사용 가능. 글리세롤/PBS 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026562-100 Anti-OPLAH Antibody, 5-oxoprolinase (ATP-hydrolysing) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026562-25 Anti-OPLAH Antibody, 5-oxoprolinase (ATP-hydrolysing) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-OPLAH Antibody
Anti-OPLAH Antibody
Target Information
- Target Protein: 5-oxoprolinase (ATP-hydrolysing)
- Target Gene: OPLAH
- Alternative Gene Names: 5-Opase, OPLA
Product Description
Polyclonal antibody against human OPLAH (5-oxoprolinase, ATP-hydrolysing).
Recommended for applications such as immunohistochemistry (IHC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTY
Species Reactivity
- Verified Reactivity: Human
- Interspecies Homology:
- Rat (ENSRNOG00000011781): 94%
- Mouse (ENSMUSG00000022562): 93%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as ligand |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



