CacheBy
Atlas Antibodies Anti-OPLAH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OPLAH Antibody

상품 한눈에 보기

인간 OPLAH 단백질을 인식하는 토끼 폴리클로날 항체. 5-oxoprolinase(ATP-hydrolysing) 검출에 적합. PrEST 항원으로 친화 정제됨. IHC 등 다양한 응용에 사용 가능. 글리세롤/PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026562-100 Anti-OPLAH Antibody, 5-oxoprolinase (ATP-hydrolysing) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026562-25 Anti-OPLAH Antibody, 5-oxoprolinase (ATP-hydrolysing) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OPLAH Antibody

Anti-OPLAH Antibody

Target Information

  • Target Protein: 5-oxoprolinase (ATP-hydrolysing)
  • Target Gene: OPLAH
  • Alternative Gene Names: 5-Opase, OPLA

Product Description

Polyclonal antibody against human OPLAH (5-oxoprolinase, ATP-hydrolysing).
Recommended for applications such as immunohistochemistry (IHC).

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTY

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Homology:
    • Rat (ENSRNOG00000011781): 94%
    • Mouse (ENSMUSG00000022562): 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as ligand
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.