CacheBy
Atlas Antibodies Anti-ODF2L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ODF2L Antibody

상품 한눈에 보기

사람 ODF2L 단백질을 인식하는 토끼 유래 폴리클로나 항체. 면역조직화학 등 다양한 연구용 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적이며 마우스, 랫과도 유사성 있음. PBS와 글리세롤 완충용액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028333-100 Anti-ODF2L Antibody, outer dense fiber of sperm tails 2-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028333-25 Anti-ODF2L Antibody, outer dense fiber of sperm tails 2-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ODF2L Antibody

Anti-ODF2L Antibody

Target: outer dense fiber of sperm tails 2-like (ODF2L)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Other research applications

Product Description

Polyclonal antibody against human ODF2L protein.


Alternative Gene Names

  • KIAA1229

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein outer dense fiber of sperm tails 2-like
Target Gene ODF2L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LLLPLFKDTIEKINFENANLSALNLKISEQKEILIKELDTFKSVKLALEHLLRKRDYKQTGDNLSSMLLENLTDNESENTNLKKKVFEKE
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028256 (66%), Rat ENSRNOG00000014059 (64%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2), 40% glycerol
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.