Atlas Antibodies Anti-NUP153 Antibody

상품 한눈에 보기

Human NUP153 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용 분야에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 고품질 항체입니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA027896-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027896-100 Anti-NUP153 Antibody, nucleoporin 153kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027896-25 Anti-NUP153 Antibody, nucleoporin 153kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NUP153 Antibody

Anti-NUP153 Antibody

Target: nucleoporin 153kDa (NUP153)
Type: Polyclonal Antibody against Human NUP153
Supplier: Atlas Antibodies

Recommended Applications

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human NUP153.
Alternative Gene Name: HNUP153

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

GQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPITSSSLPTFNFSSPEITTSSPSPINSSQALTNKVQMTSP

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000001456	79%
Mouse	ENSMUSG00000021374	79%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand