CacheBy
Atlas Antibodies Anti-NUMA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUMA1 Antibody

상품 한눈에 보기

Human NUMA1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 비교 및 siRNA 노크다운을 통한 검증 완료. 고순도 PrEST 항원으로 친화 정제된 신뢰성 높은 연구용 시약.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA029912-100 Anti-NUMA1 Antibody, nuclear mitotic apparatus protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029912-25 Anti-NUMA1 Antibody, nuclear mitotic apparatus protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUMA1 Antibody

Anti-NUMA1 Antibody

Target: Nuclear mitotic apparatus protein 1 (NUMA1)
Supplier: Atlas Antibodies


  • IHC (Independent validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic validation): Genetic validation in Western blot by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human NUMA1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Nuclear mitotic apparatus protein 1
Target Gene NUMA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse: 87% (ENSMUSG00000066306), Rat: 87% (ENSRNOG00000000417)

Antigen Sequence:
IRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKEL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.