
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NUMBL Antibody
상품 한눈에 보기
Human NUMBL 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 인간 반응성이 검증되었으며, 안정적인 PBS/glycerol 버퍼에 보존됩니다.
- 카탈로그번호
- HPA058251-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058251-100 Anti-NUMBL Antibody, numb homolog (Drosophila)-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058251-25 Anti-NUMBL Antibody, numb homolog (Drosophila)-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NUMBL Antibody
Anti-NUMBL Antibody
Target: numb homolog (Drosophila)-like
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against Human NUMBL
Alternative Gene Names
CAG3A, CTG3a, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | numb homolog (Drosophila)-like |
| Target Gene | NUMBL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000063160 (88%), Rat ENSRNOG00000020867 (86%) |
Epitope Sequence:
PTMPPALQPFPAPVGPFDAAPAQVAVFLPPPHMQPPFVPAYPGLGYPPMP
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



