CacheBy
Atlas Antibodies Anti-NUF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUF2 Antibody

상품 한눈에 보기

Human NUF2 단백질을 인식하는 토끼 폴리클로날 항체로, NDC80 키네토코어 복합체 연구에 적합. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 사용 가능. CDCA1, NUF2R 등 대체 유전자명으로도 알려짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA059692-100 Anti-NUF2 Antibody, NUF2, NDC80 kinetochore complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059692-25 Anti-NUF2 Antibody, NUF2, NDC80 kinetochore complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUF2 Antibody

Anti-NUF2 Antibody

Target: NUF2, NDC80 kinetochore complex component
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NUF2.


Alternative Gene Names

CDCA1, CT106, NUF2R

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein NUF2, NDC80 kinetochore complex component
Target Gene NUF2
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000002711 (82%), Mouse ENSMUSG00000026683 (72%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.