CacheBy
Atlas Antibodies Anti-NUDT22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDT22 Antibody

상품 한눈에 보기

Human NUDT22 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB(재조합 발현 검증), ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 상동성을 보여 다양한 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039334-100 Anti-NUDT22 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039334-25 Anti-NUDT22 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDT22 Antibody

Anti-NUDT22 Antibody

nudix (nucleoside diphosphate linked moiety X)-type motif 22


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human NUDT22


Alternative Gene Names

  • MGC13045

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nudix (nucleoside diphosphate linked moiety X)-type motif 22
Target Gene NUDT22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGH
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000021158 (94%)
Mouse ENSMUSG00000037349 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.