CacheBy
Atlas Antibodies Anti-NUDT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDT2 Antibody

상품 한눈에 보기

Human NUDT2 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 유사도(마우스 91%, 랫트 91%)를 보입니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA058623-100 Anti-NUDT2 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058623-25 Anti-NUDT2 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDT2 Antibody

Anti-NUDT2 Antibody

Target Information

  • Target Protein: nudix (nucleoside diphosphate linked moiety X)-type motif 2
  • Target Gene: NUDT2
  • Alternative Gene Names: APAH1

Product Description

Polyclonal antibody against human NUDT2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000028443): 91%
  • Rat (ENSRNOG00000055633): 91%
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Reference

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.