Atlas Antibodies Anti-NUDT2 Antibody

상품 한눈에 보기

Human NUDT2 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 유사도(마우스 91%, 랫트 91%)를 보입니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호: HPA058623-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058623-100 Anti-NUDT2 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058623-25 Anti-NUDT2 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NUDT2 Antibody

Anti-NUDT2 Antibody

Target Information

Target Protein: nudix (nucleoside diphosphate linked moiety X)-type motif 2
Target Gene: NUDT2
Alternative Gene Names: APAH1

Product Description

Polyclonal antibody against human NUDT2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000028443): 91%
Rat (ENSRNOG00000055633): 91%

Recommended Applications

Western Blot (WB)
Immunocytochemistry (ICC)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand