Atlas Antibodies Anti-NUDT21 Antibody

상품 한눈에 보기

Human NUDT21 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 연구 응용에 적합. CFIM25/CPSF5 유전자 대체명 포함. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA074228-100 Anti-NUDT21 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 21 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA074228-25 Anti-NUDT21 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 21 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: nudix (nucleoside diphosphate linked moiety X)-type motif 21
Target Gene: NUDT21
Alternative Gene Names: CFIM25, CPSF5

Polyclonal antibody against human NUDT21.
Recommended for various research applications including immunohistochemistry (IHC).

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
DEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLP

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.