CacheBy
Atlas Antibodies Anti-NUBPL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUBPL Antibody

상품 한눈에 보기

Human NUBPL 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증되었고, Rat 및 Mouse와 높은 상동성을 가짐. 40% glycerol/PBS 완충액에 보존제 포함.

카탈로그번호
HPA029203-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029203-100 Anti-NUBPL Antibody, nucleotide binding protein-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029203-25 Anti-NUBPL Antibody, nucleotide binding protein-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUBPL Antibody

Anti-NUBPL Antibody

Target: nucleotide binding protein-like (NUBPL)
Type: Polyclonal Antibody against Human NUBPL


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the human NUBPL protein.


Alternative Gene Names

C14orf127, FLJ12660, huInd1, IND1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nucleotide binding protein-like
Target Gene NUBPL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGNPELSQSNLMRPLLNYGIACMSMGFLVEESEPVVWRG

Species Reactivity

항목 내용
Verified Species Human
Ortholog Sequence Identity Rat ENSRNOG00000027444 (92%)
Mouse ENSMUSG00000035142 (91%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.