CacheBy
Atlas Antibodies Anti-NUCKS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUCKS1 Antibody

상품 한눈에 보기

Human NUCKS1 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 및 면역세포화학(ICC) 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. Human, Rat, Mouse 종에 반응성이 검증되었습니다.

카탈로그번호
HPA063843-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063843-100 Anti-NUCKS1 Antibody, nuclear casein kinase and cyclin-dependent kinase substrate 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063843-25 Anti-NUCKS1 Antibody, nuclear casein kinase and cyclin-dependent kinase substrate 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUCKS1 Antibody

Anti-NUCKS1 Antibody

Full name: Nuclear casein kinase and cyclin-dependent kinase substrate 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NUCKS1.


Alternative Gene Names

  • NUCKS

Open Datasheet


Target Information

항목 내용
Target Protein nuclear casein kinase and cyclin-dependent kinase substrate 1
Target Gene NUCKS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000047287 (100%), Mouse ENSMUSG00000026434 (98%)

Antigen Sequence:

MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.