CacheBy
Atlas Antibodies Anti-NUBP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUBP1 Antibody

상품 한눈에 보기

Human NUBP1 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립적·유전적 검증 완료. 고순도 Affinity 정제 제품으로 높은 특이성과 재현성 제공. NBP1, NBP35 유전자 인식.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041799-100 Anti-NUBP1 Antibody, nucleotide binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041799-25 Anti-NUBP1 Antibody, nucleotide binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUBP1 Antibody

Anti-NUBP1 Antibody

Target: Nucleotide binding protein 1 (NUBP1)
Type: Polyclonal Antibody against Human NUBP1
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic validation): Genetic validation in WB by siRNA knockdown.

Product Description

Polyclonal antibody against human NUBP1, validated for immunohistochemistry and western blot applications.


Alternative Gene Names

NBP1, NBP35

Open Datasheet (PDF)


Antigen Information

  • Target Protein: Nucleotide binding protein 1
  • Target Gene: NUBP1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    TSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVEN

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000002574 89%
Mouse ENSMUSG00000022503 89%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.