Atlas Antibodies Anti-NUBP1 Antibody

상품 한눈에 보기

Human NUBP1 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립적·유전적 검증 완료. 고순도 Affinity 정제 제품으로 높은 특이성과 재현성 제공. NBP1, NBP35 유전자 인식.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041799-100 Anti-NUBP1 Antibody, nucleotide binding protein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041799-25 Anti-NUBP1 Antibody, nucleotide binding protein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Nucleotide binding protein 1 (NUBP1)
Type: Polyclonal Antibody against Human NUBP1
Supplier: Atlas Antibodies

IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic validation): Genetic validation in WB by siRNA knockdown.

Polyclonal antibody against human NUBP1, validated for immunohistochemistry and western blot applications.

NBP1, NBP35

Target Protein: Nucleotide binding protein 1
Target Gene: NUBP1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
TSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVEN
```

Human

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000002574	89%
Mouse	ENSMUSG00000022503	89%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand