CacheBy
Atlas Antibodies Anti-NUBP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUBP1 Antibody

상품 한눈에 보기

Human NUBP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. 독립적 항체 비교와 siRNA knockdown으로 검증되었습니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041656-100 Anti-NUBP1 Antibody, nucleotide binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041656-25 Anti-NUBP1 Antibody, nucleotide binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUBP1 Antibody

Anti-NUBP1 Antibody

Target: nucleotide binding protein 1 (NUBP1)
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic validation): Genetic validation in WB by siRNA knockdown.

Product Description

Polyclonal antibody against human NUBP1.


Alternative Gene Names

NBP1, NBP35

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nucleotide binding protein 1
Target Gene NUBP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVEN

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Mouse ENSMUSG00000022503 89%
Rat ENSRNOG00000002574 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.