CacheBy
Atlas Antibodies Anti-NUB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUB1 Antibody

상품 한눈에 보기

인간 NUB1 단백질을 표적으로 하는 폴리클로날 항체입니다. Rabbit에서 생산되었으며 IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며 Human 반응성이 검증되었습니다. 40% glycerol/PBS 완충액에 보존제 포함.

카탈로그번호
HPA053648-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053648-100 Anti-NUB1 Antibody, negative regulator of ubiquitin-like proteins 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053648-25 Anti-NUB1 Antibody, negative regulator of ubiquitin-like proteins 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUB1 Antibody

Anti-NUB1 Antibody

제품 개요

  • Target Protein: Negative regulator of ubiquitin-like proteins 1
  • Description: Polyclonal Antibody against Human NUB1
  • Alternative Gene Names: BS4, NYREN18
  • Applications: Immunohistochemistry (IHC), Western Blot (WB)

Open Datasheet

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    DNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000009282 86%
Mouse ENSMUSG00000028954 84%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Material Safety Data Sheet MSDS - Sodium Azide

사용 시 주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 각 응용에 맞게 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.