CacheBy
Atlas Antibodies Anti-NT5C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NT5C Antibody

상품 한눈에 보기

인간 NT5C 단백질을 대상으로 한 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. Human 및 Rat 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존됩니다.

카탈로그번호
HPA023632-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023632-100 Anti-NT5C Antibody, 5`, 3`-nucleotidase, cytosolic 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023632-25 Anti-NT5C Antibody, 5`, 3`-nucleotidase, cytosolic 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NT5C Antibody

Anti-NT5C Antibody

Target Information

  • Target Protein: 5', 3'-nucleotidase, cytosolic
  • Target Gene: NT5C
  • Alternative Gene Names: cdN, DNT-1, DNT1, PN-I, UMPH2

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL

Verified Species Reactivity

  • Human
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000020736 85%
Rat ENSRNOG00000003650 83%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.