Atlas Antibodies Anti-NPRL2 Antibody

상품 한눈에 보기

Human NPRL2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 호스트에서 생성되었으며, PrEST 항원으로 친화 정제되었습니다. PBS/glycerol 버퍼에 보존제가 포함되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038197-100 Anti-NPRL2 Antibody, nitrogen permease regulator-like 2 (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038197-25 Anti-NPRL2 Antibody, nitrogen permease regulator-like 2 (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nitrogen permease regulator-like 2 (S. cerevisiae)

Polyclonal Antibody against Human NPRL2

항목	내용
Target Protein	nitrogen permease regulator-like 2 (S. cerevisiae)
Target Gene	NPRL2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000021660 (97%), Mouse ENSMUSG00000010057 (97%)

Antigen Sequence:
KLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIICW

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand