AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NPPC Antibody
상품 한눈에 보기
인간 NPPC 단백질을 인식하는 토끼 폴리클로날 항체로, 나트륨이뇨 펩타이드 C 연구에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 인간에 대한 검증된 반응성과 높은 종간 상동성을 보입니다.
- 카탈로그번호
- HPA035362-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035362-100 Anti-NPPC Antibody, natriuretic peptide C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035362-25 Anti-NPPC Antibody, natriuretic peptide C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NPPC Antibody
Anti-NPPC Antibody
Target: Natriuretic peptide C (NPPC)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.
Product Description
- Polyclonal antibody against human NPPC
- Host: Rabbit
- Isotype: IgG
- Purification: Affinity purified using the PrEST antigen as affinity ligand
Alternative Gene Names
CNP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Natriuretic peptide C |
| Target Gene | NPPC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC |
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Rat ENSRNOG00000018854 (95%)
- Mouse ENSMUSG00000026241 (92%)
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.