CacheBy
Atlas Antibodies Anti-NPPC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPPC Antibody

상품 한눈에 보기

인간 NPPC 단백질을 인식하는 토끼 폴리클로날 항체로, 나트륨이뇨 펩타이드 C 연구에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 인간에 대한 검증된 반응성과 높은 종간 상동성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035362-100 Anti-NPPC Antibody, natriuretic peptide C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035362-25 Anti-NPPC Antibody, natriuretic peptide C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPPC Antibody

Anti-NPPC Antibody

Target: Natriuretic peptide C (NPPC)
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.


Product Description

  • Polyclonal antibody against human NPPC
  • Host: Rabbit
  • Isotype: IgG
  • Purification: Affinity purified using the PrEST antigen as affinity ligand

Alternative Gene Names

CNP

Open Datasheet


Target Information

항목 내용
Target Protein Natriuretic peptide C
Target Gene NPPC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Species Reactivity

  • Verified Species: Human
  • Ortholog Identity:
    • Rat ENSRNOG00000018854 (95%)
    • Mouse ENSMUSG00000026241 (92%)

Buffer Information


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.