원본

Atlas Antibodies Anti-NPR3 Antibody

상품 한눈에 보기

Human NPR3 단백질을 타깃으로 하는 폴리클로날 래빗 항체. IHC 및 WB에서 RNA-seq 데이터 기반 Orthogonal Validation 수행. 고순도 Affinity 정제, 다양한 조직 및 세포주에서 단백질 발현 검증에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031065-100 Anti-NPR3 Antibody, natriuretic peptide receptor 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031065-25 Anti-NPR3 Antibody, natriuretic peptide receptor 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Natriuretic Peptide Receptor 3 (NPR3)
Supplier: Atlas Antibodies

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal Antibody against Human NPR3.

ANPRC, C5orf23, FLJ14054, GUCY2B, NPRC

항목	내용
Target Protein	Natriuretic peptide receptor 3
Target Gene	NPR3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSW
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000022206 (93%), Rat ENSRNOG00000019184 (92%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand