Atlas Antibodies Anti-NPHP1 Antibody

상품 한눈에 보기

Human NPHP1 단백질을 인식하는 Rabbit Polyclonal 항체로, nephronophthisis 1 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 응용에 사용할 수 있습니다. PBS/glycerol buffer에 보존되어 안정적입니다.

카탈로그번호: HPA046093-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046093-100 Anti-NPHP1 Antibody, nephronophthisis 1 (juvenile) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046093-25 Anti-NPHP1 Antibody, nephronophthisis 1 (juvenile) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NPHP1 Antibody

Anti-NPHP1 Antibody

Target Information

Target Protein: nephronophthisis 1 (juvenile)
Target Gene: NPHP1
Alternative Gene Names: JBTS4, NPH1, SLSN1

Product Description

Polyclonal Antibody against Human NPHP1.

Recommended Applications

Immunohistochemistry (IHC)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

TVEDTNGSETGFRAWNVQSRGRIFLVSKPVLQINTVDVLTTMGAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000027378): 59%
Rat (ENSRNOG00000015756): 57%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Storage	Store at recommended conditions. Gently mix before use.