CacheBy
Atlas Antibodies Anti-NPHP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPHP3 Antibody

상품 한눈에 보기

인간 NPHP3 단백질을 인식하는 토끼 폴리클로날 항체로, 신장 질환 연구에 적합합니다. PrEST 항원으로 특이 정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 인간에 반응하며, 높은 종간 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA009150-100 Anti-NPHP3 Antibody, nephronophthisis 3 (adolescent) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009150-25 Anti-NPHP3 Antibody, nephronophthisis 3 (adolescent) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPHP3 Antibody

Anti-NPHP3 Antibody

Target Information

  • Target Protein: nephronophthisis 3 (adolescent)
  • Target Gene: NPHP3
  • Alternative Gene Names: CFAP31, FLJ30691, FLJ36696, KIAA2000, MKS7, NPH3, SLSN3

Product Description

Polyclonal antibody against human NPHP3.

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PEFAHSSIDVEGPFANVNRDDWDIAVASLLQVTPLFSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000032558 (90%)
  • Rat ENSRNOG00000048978 (89%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.