CacheBy
Atlas Antibodies Anti-NPEPL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPEPL1 Antibody

상품 한눈에 보기

Human NPEPL1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036356-100 Anti-NPEPL1 Antibody, aminopeptidase-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036356-25 Anti-NPEPL1 Antibody, aminopeptidase-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPEPL1 Antibody

Anti-NPEPL1 Antibody

Target Protein: aminopeptidase-like 1
Product Type: Polyclonal Antibody against Human NPEPL1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human NPEPL1 protein (aminopeptidase-like 1). It is affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • bA261P9.2
  • FLJ11583

Open Datasheet (PDF)


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RAFPLFTHRSGASRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFG

Species Reactivity

  • Verified: Human
  • Interspecies Information:
    • Mouse (ENSMUSG00000039263) – 89% identity
    • Rat (ENSRNOG00000028384) – 87% identity

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen
Storage Condition Gently mix before use; determine optimal concentration per application
Safety Note Contains sodium azide (Material Safety Data Sheet)

Notes

  • Mix gently before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.