
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NPC2 Antibody
상품 한눈에 보기
인간 NPC2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정교한 orthogonal 검증 완료. 인간, 생쥐, 랫드 반응성 확인. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA000835-100 Anti-NPC2 Antibody, Niemann-Pick disease, type C2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000835-25 Anti-NPC2 Antibody, Niemann-Pick disease, type C2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NPC2 Antibody
Anti-NPC2 Antibody
Target Information
- Target Protein: Niemann-Pick disease, type C2
- Target Gene: NPC2
- Alternative Gene Names: EDDM1, HE1, NP-C2
Product Description
Polyclonal antibody against human NPC2.
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression cell lines.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSH
Species Reactivity
- Verified Reactivity: Human, Mouse, Rat
- Interspecies Information:
- Rat (ENSRNOG00000012062): 82% sequence identity
- Mouse (ENSMUSG00000021242): 81% sequence identity
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage Note | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



