CacheBy
Atlas Antibodies Anti-NPC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPC2 Antibody

상품 한눈에 보기

인간 NPC2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정교한 orthogonal 검증 완료. 인간, 생쥐, 랫드 반응성 확인. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA000835-100 Anti-NPC2 Antibody, Niemann-Pick disease, type C2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000835-25 Anti-NPC2 Antibody, Niemann-Pick disease, type C2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPC2 Antibody

Anti-NPC2 Antibody

Target Information

  • Target Protein: Niemann-Pick disease, type C2
  • Target Gene: NPC2
  • Alternative Gene Names: EDDM1, HE1, NP-C2

Product Description

Polyclonal antibody against human NPC2.

  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • WB (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression cell lines.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSH

Species Reactivity

  • Verified Reactivity: Human, Mouse, Rat
  • Interspecies Information:
    • Rat (ENSRNOG00000012062): 82% sequence identity
    • Mouse (ENSMUSG00000021242): 81% sequence identity

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Note Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Reference

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.