CacheBy
Atlas Antibodies Anti-NPC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPC1 Antibody

상품 한눈에 보기

Human NPC1 단백질을 인식하는 토끼 폴리클로날 항체로, Niemann-Pick disease type C1 연구에 적합. PrEST 항원을 이용해 친화정제됨. IHC 등 다양한 응용에 사용 가능. PBS/glycerol 버퍼에 보존제 포함.

카탈로그번호
HPA026618-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026618-100 Anti-NPC1 Antibody, Niemann-Pick disease, type C1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026618-25 Anti-NPC1 Antibody, Niemann-Pick disease, type C1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPC1 Antibody

Anti-NPC1 Antibody

Overview

Polyclonal antibody against Human NPC1, associated with Niemann-Pick disease type C1. Suitable for immunohistochemistry and related research applications.

  • Immunohistochemistry (IHC)

Product Description

  • Type: Polyclonal Antibody
  • Target Protein: Niemann-Pick disease, type C1
  • Target Gene: NPC1
  • Host: Rabbit
  • Isotype: IgG
  • Purification: Affinity purified using the PrEST antigen as affinity ligand
  • Buffer: 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNITDQFCNASVVD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000024413 83%
Rat ENSRNOG00000012016 81%

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.