CacheBy
Atlas Antibodies Anti-BFSP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BFSP1 Antibody

상품 한눈에 보기

Human BFSP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 사람에 대한 검증 완료, 쥐·마우스와도 높은 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040748-100 Anti-BFSP1 Antibody, beaded filament structural protein 1, filensin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040748-25 Anti-BFSP1 Antibody, beaded filament structural protein 1, filensin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BFSP1 Antibody

Anti-BFSP1 Antibody

Target: beaded filament structural protein 1 (filensin)
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human BFSP1.


Alternative Gene Names

CP115, CP94, filensin, LIFL-H

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Beaded filament structural protein 1 (filensin)
Target Gene BFSP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SAHECHDDEIQLYNEQIETLRKEIEETERVLEKSSYDCRQLAVAQQTLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKD

Species Reactivity

항목 내용
Verified Species Human
Interspecies Homology Rat ENSRNOG00000005707 (82%), Mouse ENSMUSG00000027420 (79%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
Independent Validation
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.