
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BFSP1 Antibody
상품 한눈에 보기
Human BFSP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 사람에 대한 검증 완료, 쥐·마우스와도 높은 상동성 보유.
- 카탈로그번호
- HPA040748-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040748-100 Anti-BFSP1 Antibody, beaded filament structural protein 1, filensin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040748-25 Anti-BFSP1 Antibody, beaded filament structural protein 1, filensin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BFSP1 Antibody
Anti-BFSP1 Antibody
Target: beaded filament structural protein 1 (filensin)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human BFSP1.
Alternative Gene Names
CP115, CP94, filensin, LIFL-H
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Beaded filament structural protein 1 (filensin) |
| Target Gene | BFSP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SAHECHDDEIQLYNEQIETLRKEIEETERVLEKSSYDCRQLAVAQQTLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKD |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Interspecies Homology | Rat ENSRNOG00000005707 (82%), Mouse ENSMUSG00000027420 (79%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



