CacheBy
Atlas Antibodies Anti-BEX4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BEX4 Antibody

상품 한눈에 보기

인간 BEX4 단백질을 인식하는 토끼 폴리클로날 항체. 면역조직화학 등 다양한 연구용 응용에 적합. 고순도 친화정제 방식으로 제조. 인간에 대한 반응성 검증 완료. 글리세롤 기반 안정화 완충액 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA051935-100 Anti-BEX4 Antibody, brain expressed, X-linked 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051935-25 Anti-BEX4 Antibody, brain expressed, X-linked 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BEX4 Antibody

Anti-BEX4 Antibody

Target: brain expressed, X-linked 4 (BEX4)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human BEX4 protein.

Alternative Gene Names

BEXL1, FLJ10097

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Target Information

항목 내용
Target Protein brain expressed, X-linked 4
Target Gene BEX4
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000060103 (72%)
  • Mouse ENSMUSG00000047844 (70%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.