CacheBy
Atlas Antibodies Anti-BEX5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BEX5 Antibody

상품 한눈에 보기

Human BEX5 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC Orthogonal 검증 완료. Recombinant PrEST 항원으로 정제된 고품질 항체. Human 반응성 검증 및 RNA-seq 데이터 기반 단백질 발현 비교에 적합.

카탈로그번호
HPA059058-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059058-100 Anti-BEX5 Antibody, brain expressed, X-linked 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059058-25 Anti-BEX5 Antibody, brain expressed, X-linked 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BEX5 Antibody

Anti-BEX5 Antibody

Target: brain expressed, X-linked 5 (BEX5)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human BEX5


Alternative Gene Names

NGFRAP1L1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein brain expressed, X-linked 5
Target Gene BEX5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000040850 (32%), Rat ENSRNOG00000060340 (32%)

Antigen Sequence:
NKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDGDD


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.