Atlas Antibodies Anti-BBS5 Antibody

상품 한눈에 보기

인간 BBS5 단백질을 인식하는 토끼 폴리클로날 항체로 Bardet-Biedl 증후군 연구에 적합. PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 응용에 사용 가능. 인간에 대해 검증되었으며 마우스, 랫과 높은 상동성 보유.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046125-100 Anti-BBS5 Antibody, Bardet-Biedl syndrome 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046125-25 Anti-BBS5 Antibody, Bardet-Biedl syndrome 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-BBS5 Antibody

Anti-BBS5 Antibody

Target Information

Target Protein: Bardet-Biedl syndrome 5
Target Gene: BBS5
Alternative Gene Names: DKFZp762I194

Product Description

Polyclonal antibody against human BBS5, designed for research use in studying Bardet-Biedl syndrome 5.
Affinity purified using the PrEST antigen as affinity ligand.

Recommended Applications

Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000007127	92%
Mouse	ENSMUSG00000063145	92%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.