CacheBy
Atlas Antibodies Anti-BBS4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BBS4 Antibody

상품 한눈에 보기

인간 BBS4 단백질을 인식하는 폴리클로날 항체로 Bardet-Biedl 증후군 연구에 적합함. IHC 및 WB 응용에 권장. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 높은 종간 반응성(마우스 92%, 랫 91%)을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039418-100 Anti-BBS4 Antibody, Bardet-Biedl syndrome 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039418-25 Anti-BBS4 Antibody, Bardet-Biedl syndrome 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BBS4 Antibody

Anti-BBS4 Antibody

Target Information

  • Target Protein: Bardet-Biedl syndrome 4
  • Target Gene: BBS4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000025235 (92%)
  • Rat ENSRNOG00000026171 (91%)

Product Description

Polyclonal Antibody against Human BBS4
Open Datasheet

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.