CacheBy
Atlas Antibodies Anti-BBS9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BBS9 Antibody

상품 한눈에 보기

Human BBS9 단백질을 인식하는 Rabbit Polyclonal 항체로 Bardet-Biedl syndrome 9 연구용. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화정제됨. Human에 대해 검증되었으며 Mouse, Rat과 높은 상동성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021289-100 Anti-BBS9 Antibody, Bardet-Biedl syndrome 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021289-25 Anti-BBS9 Antibody, Bardet-Biedl syndrome 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BBS9 Antibody

Anti-BBS9 Antibody

Target Information

  • Target Protein: Bardet-Biedl syndrome 9
  • Target Gene: BBS9
  • Alternative Gene Names: B1, PTHB1

면역조직화학(IHC) 등 다양한 연구 응용에 사용 가능

Product Description

Polyclonal Antibody against Human BBS9

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000035919 85%
Rat ENSRNOG00000015189 85%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 실험 목적에 따라 사용자가 결정해야 합니다.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.